RegulonDB RegulonDB 10.8: Amino acid Sequence
putative transcriptional regulator GcvR Amino Acid Sequence


Size: 190

Fasta

 

>putative transcriptional regulator GcvR E. coli K12. Version NC_000913.3 GI:556503834
MTLSSQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNA
ITLIESTLPLKGAELDLLIVMKRTTARPRPPMPASVWVQVDVADSPHLIERFTALFDAHH
MNIAELVSRTQPAENERAAQLHIQITAHSPASADAANIEQAFKALCTELNAQGSINVVNY
SQHDEQDGVK
              
                            

Download fasta file
RegulonDB