RegulonDB RegulonDB 10.9: Amino acid Sequence
hydrogenase 4 component A Amino Acid Sequence


Size: 205

Fasta

 

>hydrogenase 4 component A E. coli K12. Version NC_000913.3 GI:556503834
MNRFVVAEPLWCTGCNTCLAACSDVHKTQGLQQHPRLALAKTSTITAPVVCHHCEEAPCL
QVCPVNAISQRDDAIQLNESLCIGCKLCAVVCPFGAISASGSRPVNAHAQYVFQAEGSLK
DGEENAPTQHALLRWEPGVQTVAVKCDLCDFLPEGPACVRACPNQALRLITGDSLQRQMK
EKQRLAASWFANGGEDPLSLTQEQR
              
                            

Download fasta file
RegulonDB