RegulonDB RegulonDB 10.9: Amino acid Sequence
ribosome-associated inhibitor A Amino Acid Sequence


Size: 113

Fasta

 

>stationary phase translation inhibitor and ribosome stability factor E. coli K12. Version NC_000913.3 GI:556503834
MTMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVADATINTPNGV
LVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAATSVKDANFVEEVEEE
              
                            

Download fasta file
RegulonDB