RegulonDB RegulonDB 10.9: Amino acid Sequence
ribosome maturation factor RimM Amino Acid Sequence


Size: 182

Fasta

 

>ribosome maturation factor RimM E. coli K12. Version NC_000913.3 GI:556503834
MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQL
ESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTE
GYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDP
GF
              
                            

Download fasta file
RegulonDB