RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2509 domain-containing protein YgdB Amino Acid Sequence


Size: 135

Fasta

 

>DUF2509 domain-containing protein YgdB E. coli K12. Version NC_000913.3 GI:556503834
MNREKGVSSLALVLMLLVLGSLLLQGMSQQDRSFASRVSMESQSLRRQAIVQSALAWGKM
HCWQTQPAVQCSQYAETDAQVCLRLLADNEALLIAGYEGVSLWRTGEVIDGNIVFSPRGW
SDFCPLKERALCQLP
              
                            

Download fasta file
RegulonDB