RegulonDB RegulonDB 10.9: Amino acid Sequence
prepilin-type N-terminal cleavage/methylation domain-containing protein PpdB Amino Acid Sequence


Size: 187

Fasta

 

>prepilin-type N-terminal cleavage/methylation domain-containing protein PpdB E. coli K12. Version NC_000913.3 GI:556503834
MPVKEQGFSLLEVLIAMAISSVLLLGAARFLPALQRESLTSTRKLALEDEIWLRVFTVAK
HLQRAGYCHGICTGEGLEIVGQGDCVIVQWDANSNGIWDREPVKESDQIGFRLKEHVLET
LRGATSCEGKGWDKVTNPDAIIIDTFQVVRQDVSGFSPVLTVNMRAASKSEPQTVVNASY
SVTGFNL
              
                            

Download fasta file
RegulonDB