RegulonDB RegulonDB 10.9: Amino acid Sequence
putative 5-formyltetrahydrofolate cyclo-ligase Amino Acid Sequence


Size: 182

Fasta

 

>putative 5-formyltetrahydrofolate cyclo-ligase E. coli K12. Version NC_000913.3 GI:556503834
MIRQRRRALTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAG
KRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAF
DEYGQRLGMGGGFYDRTLQNWQHYKTQPVGYAHDCQLVEKLPVEEWDIPLPAVVTPSKVW
EW
              
                            

Download fasta file
RegulonDB