RegulonDB RegulonDB 10.9: Amino acid Sequence
glycerate 2-kinase 1 Amino Acid Sequence


Size: 381

Fasta

 

>glycerate 2-kinase 1 E. coli K12. Version NC_000913.3 GI:556503834
MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAE
RHAWVTGPLGEKVNASWGISGDGKTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELILQ
ALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDISGLD
PRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKALHVD
VKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDSQSI
HGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRGAYD
NICRASRNIAATLAIGMRNAG
              
                            

Download fasta file
RegulonDB