RegulonDB RegulonDB 10.9: Amino acid Sequence
30S ribosome binding factor Amino Acid Sequence


Size: 133

Fasta

 

>30S ribosome binding factor E. coli K12. Version NC_000913.3 GI:556503834
MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDK
DEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHD
EERRVNPDDSKED
              
                            

Download fasta file
RegulonDB