RegulonDB RegulonDB 10.8: Amino acid Sequence
flagellar biosynthesis protein FliO Amino Acid Sequence


Size: 121

Fasta

 

>flagellar biosynthesis protein FliO E. coli K12. Version NC_000913.3 GI:556503834
MNNHATVQSSAPVSAAPLLQVSGALIAIIALILAAAWLVKRLGFAPKRTGVNGLKISASA
SLGARERVVVVDVEDARLVLGVTAGQINLLHKLPPSAPTEEIPQTDFQSVMKNLLKRSGR
S
              
                            

Download fasta file
RegulonDB