RegulonDB RegulonDB 10.9: Amino acid Sequence
C4-dicarboxylate transporter DcuA Amino Acid Sequence


Size: 433

Fasta

 

>C4-dicarboxylate transporter DcuA E. coli K12. Version NC_000913.3 GI:556503834
MLVVELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGNIPFDVISIIMAVIAAI
SAMQVAGGLDYLVHQTEKLLRRNPKYITILAPIVTYFLTIFAGTGNISLATLPVIAEVAK
EQGVKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGISYLHLLSVVIPSTLLAVL
VMSFLVTMLFNSKLSDDPIYRKRLEEGLVELRGEKQIEIKSGAKTSVWLFLLGVVGVVIY
AIINSPSMGLVEKPLMNTTNAILIIMLSVATLTTVICKVDTDNILNSSTFKAGMSACICI
LGVAWLGDTFVSNNIDWIKDTAGEVIQGHPWLLAVIFFFASALLYSQAATAKALMPMALA
LNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTTRIGKFVFNHPFFIPGTLGVAL
AVCFGFVLGSFML
              
                            

Download fasta file
RegulonDB