RegulonDB RegulonDB 10.8: Amino acid Sequence
DNA-binding transcriptional activator/c-di-GMP phosphodiesterase PdeL Amino Acid Sequence


Size: 362

Fasta

 

>DNA-binding transcriptional activator/c-di-GMP phosphodiesterase PdeL E. coli K12. Version NC_000913.3 GI:556503834
MNSCDFRVFLQEFGTTVHLSLPGSVSEKERLLLKLLMQGMSVTEISQYRNRSAKTISHQK
KQLFEKLGIQSDITFWRDIFFQYNPEIISATGSNSHRYINDNHYHHIVTPEAISLALENH
EFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLAESSGLIVIMTRQLMKQT
ADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVNKLGNDKIKLVLELTERNPIP
VTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDFIKIDKSFVQMASVDEISGH
IVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQGYLYSPPVPGNKFISEWVMKA
GG
              
                            

Download fasta file
RegulonDB