RegulonDB RegulonDB 10.9: Amino acid Sequence
pyridoxal phosphate/fructose-1,6-bisphosphate phosphatase Amino Acid Sequence


Size: 272

Fasta

 

>pyridoxal phosphate/fructose-1,6-bisphosphate phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MTTRVIALDLDGTLLTPKKTLLPSSIEALARAREAGYQLIIVTGRHHVAIHPFYQALALD
TPAICCNGTYLYDYHAKTVLEADPMPVIKALQLIEMLNEHHIHGLMYVDDAMVYEHPTGH
VIRTSNWAQTLPPEQRPTFTQVASLAETAQQVNAVWKFALTHDDLPQLQHFGKHVEHELG
LECEWSWHDQVDIARGGNSKGKRLTKWVEAQGWSMENVVAFGDNFNDISMLEAAGTGVAM
GNADDAVKARANIVIGDNTTDSIAQFIYSHLI
              
                            

Download fasta file
RegulonDB