RegulonDB RegulonDB 11.1: Amino acid Sequence
transglutaminase-like/TPR repeat-containing protein Amino Acid Sequence


Size: 269

Fasta

 

>transglutaminase-like/TPR repeat-containing protein E. coli K12. Version NC_000913.3 GI:556503834
MRSLADFEFNKAPLCEGMILACEAIRRDFPSQDVYDELERLVSLAKEEISQLLPLEEQLE
KLIALFYGDWGFKASRGVYRLSDALWLDQVLKNRQGSAVSLGAVLLWVANRLDLPLLPVI
FPTQLILRIECPDGEIWLINPFNGESLSEHMLDVWLKGNISPSAELFYEDLDEADNIEVI
RKLLDTLKASLMEENQMELALRTSEALLQFNPEDPYEIRDRGLIYAQLDCEHVALNDLSY
FVEQCPEDPISEMIRAQINNIAHKHIVLH
              
                            

Download fasta file
RegulonDB