RegulonDB RegulonDB 10.9: Amino acid Sequence
L,D-transpeptidase LdtD Amino Acid Sequence


Size: 615

Fasta

 

>L,D-transpeptidase LdtD E. coli K12. Version NC_000913.3 GI:556503834
MLLNMMCGRQLSAISLCLAVTFAPLFNAQADEPEVIPGDSPVAVSEQGEALPQAQATAIM
AGIQPLPEGAAEKARTQIESQLPAGYKPVYLNQLQLLYAARDMQPMWENRDAVKAFQQQL
AEVAIAGFQPQFNKWVELLTDPGVNGMARDVVLSDAMMGYLHFIANIPVKGTRWLYSSKP
YALATPPLSVINQWQLALDKGQLPTFVAGLAPQHPQYAAMHESLLALLCDTKPWPQLTGK
ATLRPGQWSNDVPALREILQRTGMLDGGPKITLPGDDTPTDAVVSPSAVTVETAETKPMD
KQTTSRSKPAPAVRAAYDNELVEAVKRFQAWQGLGADGAIGPATRDWLNVTPAQRAGVLA
LNIQRLRLLPTELSTGIMVNIPAYSLVYYQNGNQVLDSRVIVGRPDRKTPMMSSALNNVV
VNPPWNVPPTLARKDILPKVRNDPGYLESHGYTVMRGWNSREAIDPWQVDWSTITASNLP
FRFQQAPGPRNSLGRYKFNMPSSEAIYLHDTPNHNLFKRDTRALSSGCVRVNKASDLANM
LLQDAGWNDKRISDALKQGDTRYVNIRQSIPVNLYYLTAFVGADGRTQYRTDIYNYDLPA
RSSSQIVSKAEQLIR
              
                            

Download fasta file
RegulonDB