RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; uncharacterized protein YdfC Amino Acid Sequence


Size: 72

Fasta

 

>Qin prophage; uncharacterized protein YdfC E. coli K12. Version NC_000913.3 GI:556503834
MQKREPVIIAPDYTDDELYEWMRQKINAAQDLKWANEARAKQAENLSALEQDITNLEKAA
ALSIARMITYPR
              
                            

Download fasta file
RegulonDB