RegulonDB RegulonDB 11.0: Amino acid Sequence
NrdR transcriptional repressor Amino Acid Sequence


Size: 149

Fasta

 

>NrdR transcriptional repressor E. coli K12. Version NC_000913.3 GI:556503834
MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLD
KVAYIRFASVYRSFEDIKEFGEEIARLED
              
                            

Download fasta file
RegulonDB