RegulonDB RegulonDB 10.9: Amino acid Sequence
reduced ferredoxin Amino Acid Sequence


Size: 111

Fasta

 

>reduced ferredoxin E. coli K12. Version NC_000913.3 GI:556503834
MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD
SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAREH
              
                            

Download fasta file
RegulonDB