RegulonDB RegulonDB 10.9: Amino acid Sequence
MarC family putative inner membrane protein YchE Amino Acid Sequence


Size: 215

Fasta

 

>putative inner membrane protein E. coli K12. Version NC_000913.3 GI:556503834
MIQTFFDFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWI
SLFLGDTILQLFGISIDSFRIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAVRESIGV
VPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALFALCCWGLFRMAPWLVRVLRQ
TGINVITRIMGLLLMALGIEFIVTGIKGIFPGLLN
              
                            

Download fasta file
RegulonDB