RegulonDB RegulonDB 10.9: Amino acid Sequence
tRNA-specific 2-thiouridylase Amino Acid Sequence


Size: 368

Fasta

 

>tRNA-specific 2-thiouridylase E. coli K12. Version NC_000913.3 GI:556503834
MSETAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQA
VCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLG
ADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRK
IAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTL
GQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPF
TGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGII
EQRLPLPV
              
                            

Download fasta file
RegulonDB