RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar protein FliE Amino Acid Sequence


Size: 104

Fasta

 

>flagellar basal-body protein FliE E. coli K12. Version NC_000913.3 GI:556503834
MSAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDRISDTQTAARTQAEKFT
LGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV
              
                            

Download fasta file
RegulonDB