RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar basal-body MS-ring and collar protein Amino Acid Sequence


Size: 552

Fasta

 

>flagellar basal-body MS-ring and collar protein E. coli K12. Version NC_000913.3 GI:556503834
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG
GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI
SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG
RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG
RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ
SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV
DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD
SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA
EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA
LVIRQWINNDHE
              
                            

Download fasta file
RegulonDB