RegulonDB RegulonDB 11.0: Amino acid Sequence
multidrug efflux pump membrane fusion protein EmrA Amino Acid Sequence


Size: 390

Fasta

 

>multidrug efflux pump membrane fusion protein EmrA E. coli K12. Version NC_000913.3 GI:556503834
MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGN
QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMI
NSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQ
YNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPT
TPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVR
STPVAVSTAREISLAPVNKLIDDIVKANAG
              
                            

Download fasta file
RegulonDB