RegulonDB RegulonDB 10.8: Amino acid Sequence
glutamyl-Q tRNAAsp synthetase Amino Acid Sequence


Size: 308

Fasta

 

>glutamyl-Q tRNAAsp synthetase E. coli K12. Version NC_000913.3 GI:556503834
MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPP
REVPGAAETILRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHEQGLSYYCTCTRARIQS
IGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHADEKLAREDFIIHRRDGLF
AYNLAVVVDDHFQGVTEIVRGADLIEPTVRQISLYQLFGWKVPDYIHLPLALNPQGAKLS
KQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQILQSAVKNWRLTAVPESAIVN
STFSNASC
              
                            

Download fasta file
RegulonDB