RegulonDB RegulonDB 10.9: Amino acid Sequence
cytochrome bd-II ubiquinol oxidase subunit II Amino Acid Sequence


Size: 378

Fasta

 

>cytochrome bd-II ubiquinol oxidase subunit II E. coli K12. Version NC_000913.3 GI:556503834
MFDYETLRFIWWLLIGVILVVFMISDGFDMGIGCLLPLVARNDDERRIVINSVGAHWEGN
QVWLILAGGALFAAWPRVYAAAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWD
AGLVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGSFWQLLTPFPLLCGLLSLGMV
ILQGGVWLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWLWVGIDGFVLLAQDANGPS
NPLMKLVAVLPGAWMNNFVESPVLWIFPLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFG
VIFTAGITLFPFVMPSSVSPISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYYK
MWGRMTTETLRRNENELY
              
                            

Download fasta file
RegulonDB