RegulonDB RegulonDB 10.8: Amino acid Sequence
cytochrome bd-II ubiquinol oxidase subunit I Amino Acid Sequence


Size: 514

Fasta

 

>cytochrome bd-II ubiquinol oxidase subunit I E. coli K12. Version NC_000913.3 GI:556503834
MWDVIDLSRWQFALTALYHFLFVPLTLGLIFLLAIMETIYVVTGKTIYRDMTRFWGKLFG
INFALGVATGLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQR
LNKYQHLLVTWLVAFGSNLSALWILNANGWMQYPTGAHFDIDTLRMEMTSFSELVFNPVS
QVKFVHTVMAGYVTGAMFIMAISAWYLLRGRERNVALRSFAIGSVFGTLAIIGTLQLGDS
SAYEVAQVQPVKLAAMEGEWQTEPAPAPFHVVAWPEQDQERNAFALKIPALLGILATHSL
DKPVPGLKNLMAETYPRLQRGRMAWLLMQEISQGNREPHVLQAFRGLEGDLGYGMLLSRY
APDMNHVTAAQYQAAMRGAIPQVAPVFWSFRIMVGCGSLLLLVMLIALVQTLRGKIDQHR
WVLKMALWSLPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHSALTTGQLAFSLIMIVG
LYTLFLIAEVYLMQKYARLGPSAMQSEQPTQQQG
              
                            

Download fasta file
RegulonDB