RegulonDB RegulonDB 10.9: Amino acid Sequence
low activity glyoxalase ElbB Amino Acid Sequence


Size: 217

Fasta

 

>low activity glyoxalase ElbB E. coli K12. Version NC_000913.3 GI:556503834
MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTET
RNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKAL
AQAMHQAGKPLGFMCIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVV
DEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE
              
                            

Download fasta file
RegulonDB