RegulonDB RegulonDB 11.0: Amino acid Sequence
putative uncharacterized protein YjiV Amino Acid Sequence


Size: 906

Fasta

 

>putative uncharacterized protein YjiV E. coli K12. Version NC_000913.3 GI:556503834
MYVNQRQNCDCGSPVYEVAFCNDCNEPHLLARDKKGKLVQWENKGGDEFSLQDEVPVEHD
ATEEKVEKENSFQPPLIIAAGETSEAGYTLQRLDRQTRRIGVINNDSIPLIINDIEQVCS
ASGCGYRGMSGKQPFRRALLGGPFYVTNIVPTVLEYCQDFTSDEGKEGVGPDSLPGRGRR
LITFTDSRQGTARMAVRMQQEAERSRLRGSVVEILSWHQRTQTSTAPNANADLEKLAARA
KQAREQAEEYRSWGMPDQAKLSQAQAEQLEQAYQAATGGKAATILVSRTWTEMVNELKER
ADIRGPVLQYNHYLKPEVFNENGGPLKLSEMLLFREFMRRPKRTNSLETQGLVQVGYQGL
EKIHKSPLHWQEKGLTLDDWRDFLKVTLDHYVRESNFTQLDDELKNWIGSRFSSKFVRNP
ESKDPEDNQNRRWPQIRNGNVSHRLAKLLMLGAGFKTVNAATIDIINTWLKEAWAQLTGP
LAVLKPDGNRFYLPKEHMTFSLITDAWICPVTNKILDTAFKGLTPYLPTHISFEHLTLAQ
YDTFVAQKVTMPEIWKLDRSQEDYAEGLAKARDWVSHDPLIAQLRSENVWTDINDRVVEG
GFYYRTAEHSAQQSSERLQSYEKMFKNGQLNVLNCSTTMEMGVDTDRVMTLASRSQQATI
PGPEWHLNDELVVRSLGYKTVELNEFILPAKATNAVERVKDIQIHKQLNGPLSQFGQRFW
DVLFNDHEEAQSLMNNTRITGVHYTDRYLQNPVALALLGSILRPLKTKLTDGAEVTLDTL
FKDKDRPGNRPFHDWMSIADFQDFADQWFAAALGRPVELTVFDSPRDIPHHRKLTVTFED
GQVLKIRFDQGMGYWRINFSSQWHYFDFRDDVSFQLVKMAQACKEGNVANSEESWATDVL
VEVIAS
              
                            

Download fasta file
RegulonDB