RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar biosynthesis protein FliS Amino Acid Sequence


Size: 136

Fasta

 

>flagellar biosynthesis protein FliS E. coli K12. Version NC_000913.3 GI:556503834
MYAAKGTQAYAQIGVESAVMSASQQQLVTMLFDGVLSALVRASLFMQDNNQQGKGVSLSK
AINIIENGLRVSLDEESKDELTQNLIALYSYMVRRLLQANLRNDVSAVEEVEALMRNIAD
AWKESLLSPSLIQDPV
              
                            

Download fasta file
RegulonDB