RegulonDB RegulonDB 10.8: Amino acid Sequence
inner membrane protein YhiD Amino Acid Sequence


Size: 215

Fasta

 

>inner membrane protein YhiD E. coli K12. Version NC_000913.3 GI:556503834
MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD
HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI
YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED
HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS
              
                            

Download fasta file
RegulonDB