RegulonDB RegulonDB 10.9: Amino acid Sequence
redox-responsive ATPase YchF Amino Acid Sequence


Size: 363

Fasta

 

>redox-responsive ATPase YchF E. coli K12. Version NC_000913.3 GI:556503834
MGFKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKP
QRTLPTTMEFVDIAGLVKGASKGEGLGNQFLTNIRETEAIGHVVRCFENDNIIHVSGKVN
PADDIEVINTELALADLDTCERAIHRVQKKAKGGDKDAKAELAVLEKCLPQLENAGMLRA
LDLSAEEKAAIRYLSFLTLKPTMYIANVNEDGFENNPYLDQVREIAAKEGSVVVPVCAAV
EADIAELDDEERDEFMQELGLEEPGLNRVIRAGYKLLNLQTYFTAGVKEVRAWTIPVGAT
APQAAGKIHTDFEKGFIRAQTISFEDFITYKGEQGAKEAGKMRAEGKDYIVKDGDVMNFL
FNV
              
                            

Download fasta file
RegulonDB