RegulonDB RegulonDB 10.9: Amino acid Sequence
glutathione/L-cysteine ABC exporter subunit CydD Amino Acid Sequence


Size: 588

Fasta

 

>glutathione/L-cysteine ABC exporter subunit CydD E. coli K12. Version NC_000913.3 GI:556503834
MNKSRQKELTRWLKQQSVISQRWLNISRLLGFVSGILIIAQAWFMARILQHMIMENIPRE
ALLLPFTLLVLTFVLRAWVVWLRERVGYHAGQHIRFAIRRQVLDRLQQAGPAWIQGKPAG
SWATLVLEQIDDMHDYYARYLPQMALAVSVPLLIVVAIFPSNWAAALILLGTAPLIPLFM
ALVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFGRGEAEIESIRSASEDFRQRTM
EVLRLAFLSSGILEFFTSLSIALVAVYFGFSYLGELDFGHYDTGVTLAAGFLALILAPEF
FQPLRDLGTFYHAKAQAVGAADSLKTFMETPLAHPQRGEAELASTDPVTIEAEELFITSP
EGKTLAGPLNFTLPAGQRAVLVGRSGSGKSSLLNALSGFLSYQGSLRINGIELRDLSPES
WRKHLSWVGQNPQLPAATLRDNVLLARPDASEQELQAALDNAWVSEFLPLLPQGVDTPVG
DQAARLSVGQAQRVAVARALLNPCSLLLLDEPAASLDAHSEQRVMEALNAASLRQTTLMV
THQLEDLADWDVIWVMQDGRIIEQGRYAELSVAGGPFATLLAHRQEEI
              
                            

Download fasta file
RegulonDB