RegulonDB RegulonDB 10.9: Amino acid Sequence
dCTP deaminase Amino Acid Sequence


Size: 193

Fasta

 

>dCTP deaminase E. coli K12. Version NC_000913.3 GI:556503834
MRLCDRDIEAWLDEGRLSINPRPPVERINGATVDVRLGNKFRTFRGHTAAFIDLSGPKDE
VSAALDRVMSDEIVLDEGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMV
HVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGMLIGALSFEPLSGPAVRPYNRREDAKYR
NQQGAVASRIDKD
              
                            

Download fasta file
RegulonDB