RegulonDB RegulonDB 10.9: Amino acid Sequence
lipopolysaccharide core heptose (II) kinase Amino Acid Sequence


Size: 232

Fasta

 

>lipopolysaccharide core heptose (II) kinase E. coli K12. Version NC_000913.3 GI:556503834
MIQKSKIKDLVVFTDENNSKYLNVLNDFLSYNINIIKVFRSIDDTKVMLIDTDYGKLILK
VFSPKVKRNERFFKSLLKGDYYERLFEQTQKVRNEGLNTLNDFYLLAERKTLRFVHTYIM
IIEYIDGIELCDMPDIDDALKNKIQQSINALHQHGMVSGDPHRGNFIIKNGEVRIIDLSG
KRASAQRKAKDRIDLERHYGIKNEIRDLGYYLLVYRKKMRNFMRRLKGKPAR
              
                            

Download fasta file
RegulonDB