RegulonDB RegulonDB 10.10: Amino acid Sequence
ribosomal protein-arginine oxygenase Amino Acid Sequence


Size: 373

Fasta

 

>ribosomal protein-arginine oxygenase E. coli K12. Version NC_000913.3 GI:556503834
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGK
WQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGG
GVGPHLDQYDVFIIQGTGRRRWRVGEKLQMKQHCPHPDLLQVDPFEAIIDEELEPGDILY
IPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPA
DVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQG
EVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAML
AALVNSGYWFFEG
              
                            

Download fasta file
RegulonDB