RegulonDB RegulonDB 10.9: Amino acid Sequence
carbon storage regulator Amino Acid Sequence


Size: 61

Fasta

 

>carbon storage regulator E. coli K12. Version NC_000913.3 GI:556503834
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSS
Y
              
                            

Download fasta file
RegulonDB