RegulonDB RegulonDB 10.9: Amino acid Sequence
dTDP-glucose 4,6-dehydratase 2 Amino Acid Sequence


Size: 355

Fasta

 

>dTDP-glucose 4,6-dehydratase 2 E. coli K12. Version NC_000913.3 GI:556503834
MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDI
CDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALT
EDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGL
PTLITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVA
TTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLR
YAIDASKIARELGWLPQETFESGMRKTVQWYLANESWWKQVQDGSYQGERLGLKG
              
                            

Download fasta file
RegulonDB