RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF2628 domain-containing protein YigF Amino Acid Sequence


Size: 126

Fasta

 

>DUF2628 domain-containing protein YigF E. coli K12. Version NC_000913.3 GI:556503834
MSKEYMNDGSLSEKWKYRFNFYDQHGFPGFWGATPEYKAAFKALKVRQRLTIQMNFIAFF
CSWIYLFVLGLWKKAIIVLLLGILSLFVGALIGVNILGIAVAAYVAVNTNKWFYEKEVKG
LNTWSL
              
                            

Download fasta file
RegulonDB