RegulonDB RegulonDB 10.10: Amino acid Sequence
inner membrane protein Amino Acid Sequence


Size: 126

Fasta

 

>inner membrane protein E. coli K12. Version NC_000913.3 GI:556503834
MLRIFIPTSNGKISRRRYIFSFILINFIFAFLIIFFNDGEAGFLVIVSTIVLHYLVINMN
CQRLRDSGFIYIKTYVFGTLAVYIISIITMIAEDFACSGNGSMIFLICYFSTFSMLMLAP
TDSSKQ
              
                            

Download fasta file
RegulonDB