RegulonDB RegulonDB 10.9: Amino acid Sequence
ribosomal protein L11 methyltransferase Amino Acid Sequence


Size: 293

Fasta

 

>methyltransferase for 50S ribosomal subunit protein L11 E. coli K12. Version NC_000913.3 GI:556503834
MPWIQLKLNTTGANAEDLSDALMEAGAVSITFQDTHDTPVFEPLPGETRLWGDTDVIGLF
DAETDMNDVVAILENHPLLGAGFAHKIEQLEDKDWEREWMDNFHPMRFGERLWICPSWRD
VPDENAVNVMLDPGLAFGTGTHPTTSLCLQWLDSLDLTGKTVIDFGCGSGILAIAALKLG
AAKAIGIDIDPQAIQASRDNAERNGVSDRLELYLPKDQPEEMKADVVVANILAGPLRELA
PLISVLPVSGGLLGLSGILASQAESVCEAYADSFALDPVVEKEEWCRITGRKN
              
                            

Download fasta file
RegulonDB