RegulonDB RegulonDB 10.9: Amino acid Sequence
sensor lipoprotein RcsF Amino Acid Sequence


Size: 134

Fasta

 

>sensor lipoprotein RcsF E. coli K12. Version NC_000913.3 GI:556503834
MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVG
KPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYR
QAVCIGSALNITAK
              
                            

Download fasta file
RegulonDB