RegulonDB RegulonDB 10.9: Amino acid Sequence
tRNA m6t6A37 methyltransferase Amino Acid Sequence


Size: 235

Fasta

 

>tRNA m6t6A37 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQADAVRGLEAFSHLWIL
FVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSLVELKEVVCHKDSVILK
LGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAVSFTAEVEKQLLTLEKRY
PQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRVTDAGFEVFALEPR
              
                            

Download fasta file
RegulonDB