RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA polymerase III subunit θ Amino Acid Sequence


Size: 76

Fasta

 

>DNA polymerase III subunit θ E. coli K12. Version NC_000913.3 GI:556503834
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHR
LASVNLSRLPYEPKLK
              
                            

Download fasta file
RegulonDB