RegulonDB RegulonDB 10.9: Amino acid Sequence
molybdopterin adenylyltransferase Amino Acid Sequence


Size: 195

Fasta

 

>molybdopterin adenylyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAIIEQTLCE
LVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQV
GVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEV
VAAFRPKSARRDVSE
              
                            

Download fasta file
RegulonDB