RegulonDB RegulonDB 10.8: Amino acid Sequence
uncharacterized protein YbfC Amino Acid Sequence


Size: 189

Fasta

 

>uncharacterized protein YbfC E. coli K12. Version NC_000913.3 GI:556503834
MKRVLFFLLMIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPVLNNKAMWRWYQNEDI
GEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQELINTAEKTAFLGDRF
RSYIRAGIYQKKSSDPVQLLAVLDNSIMVKYFKDEKPTYARMTAHLPNKNESYECLIKIQ
HELIRSEEK
              
                            

Download fasta file
RegulonDB