RegulonDB RegulonDB 10.9: Amino acid Sequence
H repeat-associated putative transposase YdcC Amino Acid Sequence


Size: 378

Fasta

 

>H repeat-associated putative transposase YdcC E. coli K12. Version NC_000913.3 GI:556503834
MELKKLMGHISIIPDYRQAWKMEHKLSDILLLTICAVISGAEGWEDIEDFGETHPDFLKQ
YGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKDVIAIDGKTLRHSYDKS
RRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLDIKGKIITTDAMGCQKDI
AEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPAHDSYAMSEKSHGREEIRLHIV
CDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKELEMTVRYYISSADLTAEKFATAIR
NHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIAINILTNDKVFKAGLRRKMRK
AAMDRNYLASVLTGSGLS
              
                            

Download fasta file
RegulonDB