RegulonDB RegulonDB 10.9: Amino acid Sequence
putative transport protein YidE Amino Acid Sequence


Size: 553

Fasta

 

>putative transport protein YidE E. coli K12. Version NC_000913.3 GI:556503834
MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGHFVSQAGMTLSSDMLH
VIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIGGLVTAILHKLFDIPLP
VVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMAYPFGICGILFTMWMLRV
IFRVNVETEAQQHESSRTNGGALIKTINIRVENPNLHDLAIKDVPILNGDKIICSRLKRE
ETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTSLSTKGTDLRVERVVVTNEN
VLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFGDILNLVGRPSAIDAVANVLG
NAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALKLGLAGGPLIMALILGRIGSIG
KLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTLVNGEGLSWIGYGALITAVPLIT
VGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLHPTSGAAALSYATVYPLVMFLRII
TPQLLAVLFWSIG
              
                            

Download fasta file
RegulonDB