RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF480 domain-containing protein YceH Amino Acid Sequence


Size: 215

Fasta

 

>DUF480 domain-containing protein YceH E. coli K12. Version NC_000913.3 GI:556503834
MKYQLTALEARVIGCLLEKQVTTPEQYPLSVNGVVTACNQKTNREPVMNLSESEVQEQLD
NLVKRHYLRTVSGFGNRVTKYEQRFCNSEFGDLKLSAAEVALITTLLLRGAQTPGELRSR
AARMYEFSDMAEVESTLEQLANREDGPFVVRLAREPGKRENRYMHLFSGEVEDQPAVTDM
SNAVDGDLQARVEALEIEVAELKQRLDSLLAHLGD
              
                            

Download fasta file
RegulonDB