RegulonDB RegulonDB 11.0: Amino acid Sequence
UMP kinase Amino Acid Sequence


Size: 241

Fasta

 

>UMP kinase E. coli K12. Version NC_000913.3 GI:556503834
MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNL
FRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWA
EAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLKATKVDGVFTADPAKDPT
ATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT
E
              
                            

Download fasta file
RegulonDB