RegulonDB RegulonDB 10.9: Amino acid Sequence
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 Amino Acid Sequence


Size: 208

Fasta

 

>multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 E. coli K12. Version NC_000913.3 GI:556503834
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
              
                            

Download fasta file
RegulonDB